Review



coding sequence codon-optimised for s. frugiperda and synthesized  (Thermo Fisher)


Bioz Verified Symbol Thermo Fisher is a verified supplier
Bioz Manufacturer Symbol Thermo Fisher manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 90

    Structured Review

    Thermo Fisher coding sequence codon-optimised for s. frugiperda and synthesized
    Coding Sequence Codon Optimised For S. Frugiperda And Synthesized, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/coding+sequence+codon-optimised+for+s%2E+frugiperda+and+synthesized/coding+sequence+codon+optimised+for+s++frugiperda+and+synthesized/10__1042_slash_bcj20210244-173-4-10
    Average 90 stars, based on 1 article reviews
    coding sequence codon-optimised for s. frugiperda and synthesized - by Bioz Stars, 2026-09
    90/100 stars

    Images

    Related Articles

    Sequencing:

    Article Title: Identifying SARS-CoV-2 antiviral compounds by screening for small molecule inhibitors of Nsp3 papain-like protease
    Article Snippet: .. The coding sequence was codon-optimised for S. frugiperda and synthesized (GeneArt, Thermo Fisher Scientific). .. PLpro DNA was subcloned into the biGBac vector pLIB [32] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194).

    Synthesized:

    Article Title: Identifying SARS-CoV-2 antiviral compounds by screening for small molecule inhibitors of Nsp3 papain-like protease
    Article Snippet: .. The coding sequence was codon-optimised for S. frugiperda and synthesized (GeneArt, Thermo Fisher Scientific). .. PLpro DNA was subcloned into the biGBac vector pLIB [32] to include an N-terminal 3xFlag-His6 tag (sequence: MDYKDHDGDYKDHDIDYKDDDDKGSHHHHHHSAVLQ) (Addgene ID 169194).



    Similar Products

    90
    Thermo Fisher coding sequence codon-optimised for s. frugiperda and synthesized
    Coding Sequence Codon Optimised For S. Frugiperda And Synthesized, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/coding+sequence+codon-optimised+for+s%2E+frugiperda+and+synthesized/coding+sequence+codon+optimised+for+s++frugiperda+and+synthesized/10__1042_slash_bcj20210244-173-4-10
    Average 90 stars, based on 1 article reviews
    coding sequence codon-optimised for s. frugiperda and synthesized - by Bioz Stars, 2026-09
    90/100 stars
      Buy from Supplier

    Image Search Results